Introducing Our Exclusive Tirzepatide Black Friday 5 Pack!
Tirzepatide Black Friday Value Packs- Tirzepatide is an innovative dual receptor agonist that simultaneously stimulates both the GIP and GLP-1 receptors -3rd party Lab tested – 99% purity – In stock and ready to ship.
What is Tirzepatide ?
Tirzepatide is a novel dual glucose dependent insulinotropic polypeptide (GIP) and glucagon like peptide-1 (GLP-1) receptor agonist. It is designed to mimic the effects of naturally occurring GIP and GLP-1 hormones.
How Does Tirzepatide Work?
GIP and GLP-1 hormones help regulate blood sugar levels. By activating their receptors, Tirzepatide may trigger the release of insulin to lower blood glucose while suppressing glucagon which raises glucose. It was modified to be more stable compared to native GIP/GLP-1.
Disclaimer
While the known research on this molecule appears promising, it is important to note that additional studies are necessary to fully understand its potential and efficacy. We offer this product strictly for research use only, and it is not intended for human consumption or therapeutic use.
Any reference to or inference of results from human trials is provided solely for contextual reference and educational purposes. This information does not imply that we recommend or endorse the use of this or any peptide for experiments in human or veterinary studies outside of a controlled laboratory setting.
Researchers are advised to follow all applicable regulations and ethical guidelines when conducting studies with this peptide. We reserve the right to refuse to sell or discontinue the sale of our products to any customer whom we find to be misusing or promoting the misuse of our research chemicals.
What Does Research Show?
Clinical trials show Tirzepatide’s efficacy:
- Phase 3 trials showed up to 2.37% HbA1c reduction and 22.5 lb weight loss over 72 weeks. Details from press releases: SURPASS-1, SURPASS-2
- 52-week data indicates greater A1C and weight reduction than leading diabetes medications. Reported at medical conferences, see research summaries: SURPASS trials, SURMOUNT trials
- Ongoing trials are assessing cardioprotective effects. Clinical trial entries: SURMOUNT-3, SURMOUNT-4
What is the Technical Data?
Tirzepatide consists of a 39 amino acid peptide chain with the sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRGSSSSTQRLIQRLINTX, where X is an aromatic amino acid.
Additionally, key components of the structure include an N terminal histidine residue and C-terminal glutamic acid extended aromatic amino acid residue, which provide protection from degradation. Moreover, Tirzepatide also contains an aminoisobutyric acid (Aib) at position 2 for stability.
The molecular formula of tirzepatide is C188H300N56O60. It has a molecular weight of 4181.57 g/mol.
Also, structure of Tirzepatide allows it to activate both the glucose dependent insulinotropic polypeptide (GIP) receptor and glucagon like peptide 1 (GLP-1) receptor. Consequently, this dual agonism results in the unique effects of tirzepatide.
Modifications to the native GIP and GLP-1 sequences provide Tirzepatide with a half life of approximately 5 days.
Fast Order Processing
Order before 1pm EST, Monday to Friday, and we’ll ship it out the same day. Missed that window? No problem. We’ll ship your order the next business day. If you order late on a Friday, rest assured, your package heads out first thing Monday.
Plus, enjoy free shipping on orders over $399! After we ship, you’ll get a tracking email. Within 24 hours, that tracking will update. We focus on fast shipping, so order now and get your items swiftly!
